Recombinant Human Platelet basic protein (PPBP), partial (Active) | CSB-AP003511HU

Recombinant Human Platelet basic protein (PPBP) ,partial (Active) | CSB-AP003511HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Platelet Basic Protein; PBP; C-X-C Motif Chemokine 7; Leukocyte-Derived Growth Factor; LDGF; Macrophage-Derived Growth Factor; MDGFSmall-Inducible Cytokine B7; PPBP; CTAP3; CXCL7; SCYB7; TGB1; THBGB1

Gene Names: PPBP

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 59-128aa

Sequence Info: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Biological Activity: The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 18 ng/mL.

MW: 7.6 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Human Chemokine (C-X-C motif) Ligand 7 (CXCL7) , also known as neutrophil activating peptide 2 (NAP-2) , is a member of the CXC chemokines containing an ELR domain (Glu-Leu-Arg tripeptide motif) . Similar to other ELR domain containing CXC chemokines, such as IL-8 and the GRO proteins, CXCL7 binds CXCR2, chemoattracts and activates neutrophils. CXCL7, Connective Tissue Activating Protein III (CTAPIII) and βthrombogulin (βTG) , are proteolytically processed carboxylterminal fragments of platelet basic protein (PBP) which is found in the alphagranules of human platelets. Although CTAPIII, βTG, and PBP represent amino-terminal extended variants of NAP2 and possess the same CXC chemokine domains, these proteins do not exhibit CXCL7/NAP2 activity. CXCL7 induces cell migration through the G-protein-linked receptor CXCR-2.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2 (73) , NAP-2 (74) , NAP-2 (1-66) , and most potent NAP-2 (1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III (1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway: Chemokinesignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02775

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM