Recombinant Human Placenta-expressed transcript 1 protein (PLET1) | CSB-EP754399HU

Recombinant Human Placenta-expressed transcript 1 protein (PLET1) | CSB-EP754399HU | Cusabio

Alternative Name(s): C11orf34

Gene Names: PLET1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: TFIRYSSTCFTFDEYYTITLDIKASSHIYESNAVYSVFVPVNDSVYAVVMKTLDENSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQAFTVQIRALPILSTLKLREKLSTLALAAKIPQSSAFKPFFMITPKSIRLEGLANQVFS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-187aa

Sequence Info: Full length of the mature protein

MW: 24.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle.

Reference: "Identification of Plet-1 as a specific marker of early thymic epithelial progenitor cells." Depreter M.G.L., Blair N.F., Gaskell T.L., Nowell C.S., Davern K., Pagliocca A., Stenhouse F.H., Farley A.M., Fraser A., Vrana J., Robertson K., Morahan G., Tomlinson S.R., Blackburn C.C. Proc. Natl. Acad. Sci. U.S.A. 105:961-966(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6UQ28

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A