Recombinant Human Phospholipase A2 group V (PLA2G5) | CSB-YP018103HU

Recombinant Human Phospholipase A2 group V (PLA2G5) | CSB-YP018103HU | Cusabio

Alternative Name(s): Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5

Gene Names: PLA2G5

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-138aa

Sequence Info: Full Length of Mature Protein

MW: 15.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.

Reference: "Biallelic mutations in PLA2G5, encoding group V phospholipase A2, cause benign fleck retina."Sergouniotis P.I., Davidson A.E., Mackay D.S., Lenassi E., Li Z., Robson A.G., Yang X., Kam J.H., Isaacs T.W., Holder G.E., Jeffery G., Beck J.A., Moore A.T., Plagnol V., Webster A.R.Am. J. Hum. Genet. 89:782-791(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.

Involvement in disease: Fleck retina, familial benign (FRFB)

Subcellular Location: Secreted

Protein Families: Phospholipase A2 family

Tissue Specificity: Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level).

Paythway: Vascularsmoothmusclecontraction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P39877

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM