Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active) | CSB-EP017802HU

(No reviews yet) Write a Review
SKU:
CSB-EP017802HU
Availability:
3 to 7 Working Days
  • Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active)
  • Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$284.40 - $1,465.20

Description

Recombinant Human Peroxisomal biogenesis factor 19 (PEX19) (Active) | CSB-EP017802HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : 33 kDa housekeeping protein Peroxin-19 Peroxisomal farnesylated protein

Gene Names: PEX19

Research Areas: Tags & Cell Markers

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-296aa

Sequence Info: AAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQC

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ABCD1 at 5 μg/ml can bind human PEX19,the EC50 of human PEX19 protein is 22.96-33.00 μg/ml.

MW: 59.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Relevance: Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs) . Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P40855

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose