Cusabio Human Recombinants
Recombinant Human Pepsin A-5 (PGA5) | CSB-EP320706HU
- SKU:
- CSB-EP320706HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Pepsin A-5 (PGA5) | CSB-EP320706HU | Cusabio
Alternative Name(s): Pepsinogen-5
Gene Names: PGA5
Research Areas: Metabolism
Organism: Homo sapiens (Human)
AA Sequence: VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 63-388aa
Sequence Info: Full Length of Mature Protein
MW: 41.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.
Reference: "Detection of pepsin in mouth swab: correlation with clinical gastroesophageal reflux in preterm infants." Farhath S., He Z., Saslow J., Soundar S., Amendolia B., Bhat V., Pyon K., Stahl G., Mehta D., Aghai Z.H. J. Matern. Fetal. Neonatal. Med. 26:819-824(2013)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Peptidase A1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P0DJD9
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM