Recombinant Human Pepsin A-5 (PGA5) | CSB-EP320706HU

(No reviews yet) Write a Review
SKU:
CSB-EP320706HU
Availability:
13 - 23 Working Days
€266.00 - €1,440.00

Description

Recombinant Human Pepsin A-5 (PGA5) | CSB-EP320706HU | Cusabio

Alternative Name(s): Pepsinogen-5

Gene Names: PGA5

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 63-388aa

Sequence Info: Full Length of Mature Protein

MW: 41.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Reference: "Detection of pepsin in mouth swab: correlation with clinical gastroesophageal reflux in preterm infants." Farhath S., He Z., Saslow J., Soundar S., Amendolia B., Bhat V., Pyon K., Stahl G., Mehta D., Aghai Z.H. J. Matern. Fetal. Neonatal. Med. 26:819-824(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase A1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0DJD9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose