Recombinant Human Parathyroid hormone (PTH) (Active) | CSB-AP005621HU

(No reviews yet) Write a Review
SKU:
CSB-AP005621HU
Availability:
5 to 10 Working Days
  • Recombinant Human Parathyroid hormone (PTH) (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£185.60 - £396.80

Description

Recombinant Human Parathyroid hormone (PTH) (Active) | CSB-AP005621HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Parathyroid Hormone; PTH; Parathormone; Parathyrin

Gene Names: PTH

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 32-115aa

Sequence Info: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Biological Activity: The ED50 as determined by its ability to induce cAMP accumulation in MC3T3‑E1 mouse preosteoblast cells is less than 0.1 ug/ml

MW: 9 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor as parathyroid hormone and has major effects on development. Like most other protein hormones, parathyroid hormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packaged within the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secreted as a linear protein of 84 amino acids.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.

Involvement in disease: Hypoparathyroidism, familial isolated (FIH)

Subcellular Location: Secreted

Protein Families: Parathyroid hormone family

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01270

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose