Recombinant Human p53-regulated apoptosis-inducing protein 1 (TP53AIP1) | CSB-EP884624HU

Recombinant Human p53-regulated apoptosis-inducing protein 1 (TP53AIP1) | CSB-EP884624HU | Cusabio

Alternative Name(s): p53 regulated apoptosis inducing protein 1; p53-regulated apoptosis-inducing protein 1; P53AIP 1; p53AIP1; TP53AIP 1; TP53AIP1; TPIP1_HUMAN

Gene Names: TP53AIP1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-108aa

Sequence Info: Full Length of BC069399

MW: 38.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play an important role in mediating p53/TP53-dependent apoptosis.

Reference: "p53AIP1, a potential mediator of p53-dependent apoptosis, and its regulation by Ser-46-phosphorylated p53." Oda K., Arakawa H., Tanaka T., Matsuda K., Tanikawa C., Mori T., Nishimori H., Tamai K., Tokino T., Nakamura Y., Taya Y. Cell 102:849-862(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play an important role in mediating p53/TP53-dependent apoptosis.

Involvement in disease:

Subcellular Location: Mitochondrion

Protein Families:

Tissue Specificity: Only found to be expressed in thymus.

Paythway: p53signalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9HCN2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM