Recombinant Human P2Y purinoceptor 12 (P2RY12) | CSB-CF861997HU

(No reviews yet) Write a Review
SKU:
CSB-CF861997HU
Availability:
18 - 23 Working Days
£1,176.80 - £1,874.40

Description

Recombinant Human P2Y purinoceptor 12 (P2RY12) | CSB-CF861997HU | Cusabio

Alternative Name(s): ADP-glucose receptor (ADPG-R) (P2T) (P2Y(AC)) (P2Y(cyc)) (P2Y12 platelet ADP receptor) (P2Y(ADP)) (SP1999) (HORK3) (P2Y12)

Gene Names: P2RY12

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-342aa

Sequence Info: Full Length

MW: 42.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.

Reference: "Molecular bases of defective signal transduction in the platelet P2Y12 receptor of a patient with congenital bleeding." Cattaneo M., Zighetti M.L., Lombardi R., Martinez C., Lecchi A., Conley P.B., Ware J., Ruggeri Z.M. Proc. Natl. Acad. Sci. U.S.A. 100:1978-1983(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.

Involvement in disease: Bleeding disorder, platelet-type 8 (BDPLT8)

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family

Tissue Specificity: Highly expressed in the platelets, lower levels in the brain. Lowest levels in the lung, appendix, pituitary and adrenal gland. Expressed in the spinal cord and in the fetal brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9H244

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose