Recombinant Human Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1) | CSB-EP839337HU

(No reviews yet) Write a Review
SKU:
CSB-EP839337HU
Availability:
13 - 23 Working Days
  • Recombinant Human Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1) | CSB-EP839337HU | Cusabio

Alternative Name(s): Oxidoreductase NAD binding domain containing 1; Oxidoreductase NAD-binding domain-containing protein 1; Oxnad1; OXND1_HUMAN

Gene Names: OXNAD1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: AIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 18-312aa

Sequence Info: Full Length of Mature Protein

MW: 49.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Cloning and characterization of human oxidoreductase NAD-binding domain containing 1.Qiu R., Li J., Ji C., Xie Y., Mao Y.Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96HP4

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose