Recombinant Human Olfactory receptor 5V1 (OR5V1) | CSB-CF871401HU

(No reviews yet) Write a Review
SKU:
CSB-CF871401HU
Availability:
18 - 23 Working Days
$1,740.00 - $2,786.40

Description

Recombinant Human Olfactory receptor 5V1 (OR5V1) | CSB-CF871401HU | Cusabio

Alternative Name(s): Hs6M1-21 (Olfactory receptor OR6-26)

Gene Names: OR5V1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-321aa

Sequence Info: Full Length

MW: 42.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions." Barcellos L.F., May S.L., Ramsay P.P., Quach H.L., Lane J.A., Nititham J., Noble J.A., Taylor K.E., Quach D.L., Chung S.A., Kelly J.A., Moser K.L., Behrens T.W., Seldin M.F., Thomson G., Harley J.B., Gaffney P.M., Criswell L.A. PLoS Genet. 5:e1000696-e1000696(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UGF6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose