Cusabio Human Recombinants
Recombinant Human Olfactory receptor 5V1 (OR5V1) | CSB-CF871401HU
- SKU:
- CSB-CF871401HU
- Availability:
- 18 - 23 Working Days
Description
Recombinant Human Olfactory receptor 5V1 (OR5V1) | CSB-CF871401HU | Cusabio
Alternative Name(s): Hs6M1-21 (Olfactory receptor OR6-26)
Gene Names: OR5V1
Research Areas: Neuroscience
Organism: Homo sapiens (Human)
AA Sequence: MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-tagged
Expression Region: 1-321aa
Sequence Info: Full Length
MW: 42.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance:
Reference: "High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions." Barcellos L.F., May S.L., Ramsay P.P., Quach H.L., Lane J.A., Nititham J., Noble J.A., Taylor K.E., Quach D.L., Chung S.A., Kelly J.A., Moser K.L., Behrens T.W., Seldin M.F., Thomson G., Harley J.B., Gaffney P.M., Criswell L.A. PLoS Genet. 5:e1000696-e1000696(2009)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9UGF6
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A