Recombinant Human Olfactory receptor 1A1 (OR1A1) | CSB-CF865201HU

Recombinant Human Olfactory receptor 1A1 (OR1A1) | CSB-CF865201HU | Cusabio

Alternative Name(s): Olfactory receptor 17-7

Gene Names: OR1A1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-309aa

Sequence Info: Full Length

MW: 50.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Odorant receptor.

Reference: "Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2." Schmiedeberg K., Shirokova E., Weber H.P., Schilling B., Meyerhof W., Krautwurst D. J. Struct. Biol. 159:400-412(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Odorant receptor.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9P1Q5

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A