Cusabio Human Recombinants
Recombinant Human Nuclear transport factor 2 (NUTF2) | CSB-EP016214HU
- SKU:
- CSB-EP016214HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Nuclear transport factor 2 (NUTF2) | CSB-EP016214HU | Cusabio
Alternative Name(s): Placental protein 15
Gene Names: NUTF2
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-127aa
Sequence Info: Full Length
MW: 41.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.
Reference: "Identification of NTF2, a cytosolic factor for nuclear import that interacts with nuclear pore complex protein p62." Paschal B.M., Gerace L. J. Cell Biol. 129:925-937(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.
Involvement in disease:
Subcellular Location: Cytoplasm, cytosol, Nucleus outer membrane, Nucleus, nuclear pore complex, Nucleus inner membrane, Nucleus, nucleoplasm
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P61970
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM