Recombinant Human Nuclear transport factor 2 (NUTF2) | CSB-EP016214HU

(No reviews yet) Write a Review
SKU:
CSB-EP016214HU
Availability:
13 - 23 Working Days
  • Recombinant Human Nuclear transport factor 2 (NUTF2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Nuclear transport factor 2 (NUTF2) | CSB-EP016214HU | Cusabio

Alternative Name(s): Placental protein 15

Gene Names: NUTF2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-127aa

Sequence Info: Full Length

MW: 41.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.

Reference: "Identification of NTF2, a cytosolic factor for nuclear import that interacts with nuclear pore complex protein p62." Paschal B.M., Gerace L. J. Cell Biol. 129:925-937(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.

Involvement in disease:

Subcellular Location: Cytoplasm, cytosol, Nucleus outer membrane, Nucleus, nuclear pore complex, Nucleus inner membrane, Nucleus, nucleoplasm

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P61970

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose