Recombinant Human Nuclear pore membrane glycoprotein 210 (NUP210), partial | CSB-EP016195HU(C)

Recombinant Human Nuclear pore membrane glycoprotein 210 (NUP210), partial | CSB-EP016195HU(C) | Cusabio

Alternative Name(s): Nuclear envelope pore membrane protein POM 210 ;POM210Nucleoporin Nup210Pore membrane protein of 210KDA

Gene Names: NUP210

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1529-1808aa

Sequence Info: Partial

MW: 34.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Nucleoporin essential for nuclear pore assbly and fusion, nuclear pore spacing, as well as structural integrity.

Reference: Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.

Involvement in disease:

Subcellular Location: Nucleus, nuclear pore complex, Nucleus membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein

Protein Families: NUP210 family

Tissue Specificity: Ubiquitous expression, with highest levels in lung, liver, pancreas, testis, and ovary, intermediate levels in brain, kidney, and spleen, and lowest levels in heart and skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8TEM1

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM