Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial | CSB-YP3324GMY2

Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial | CSB-YP3324GMY2 | Cusabio

Target Name: S

Uniprot No: P0DTC2

Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source: Yeast

Tag Info: N-terminal 6xHis-PDI-tagged

Expression Region: 16-318aa

Sequence Description: Partial

Target Protein Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNF

Mol. Weight: 93.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.