Recombinant Human Novel Coronavirus Spike glycoprotein (S) (N501Y), partial (Active) | CSB-MP3324GMY1 (M6) k2

Recombinant Human Novel Coronavirus Spike glycoprotein (S) (N501Y) ,partial (Active) | CSB-MP3324GMY1 (M6) k2 | Cusabio

Protein Description: Partial

Alternative Name (s) :

Gene Names: S

Research Areas: Microbiology

Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-mFC-tagged

Expression Region: 319-541aa (N501Y)

Sequence Info: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (N501Y) at 2 μg/ml can bind human ACE2 (CSB-MP866317HU-B) , the EC50 is 2.492-4.401 ng/ml.

MW: 55.3kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0DTC2

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A