Recombinant Human Novel Coronavirus Spike glycoprotein (S) (N354D, D364Y), partial | CSB-MP3324GMY1 (M3)

(No reviews yet) Write a Review
SKU:
CSB-MP3324GMY1 (M3)
Availability:
3 - 7 Working Days
$134.40 - $3,630.00

Description

Recombinant Human Novel Coronavirus Spike glycoprotein (S) (N354D, D364Y), partial | CSB-MP3324GMY1 (M3) | Cusabio

Target Name: S

Uniprot No: P0DTC2

Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source: Mammalian cell

Tag Info: C-terminal 10xHis-tagged

Expression Region: 319-541aa (N354D,D364Y)

Sequence Description: Partial (S1-RBD)

Target Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWDRKRISNCVAYYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Mol. Weight: 30.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

View AllClose

0 Reviews

View AllClose