Recombinant Human Novel Coronavirus Spike glycoprotein (S) (G476S), partial (Active) | CSB-MP3324GMY1 (M4)

(No reviews yet) Write a Review
SKU:
CSB-MP3324GMY1 (M4)
Availability:
3 - 7 Working Days
€112.00 - €3,025.00

Description

Recombinant Human Novel Coronavirus Spike glycoprotein (S) (G476S), partial (Active) | CSB-MP3324GMY1 (M4) | Cusabio

Target Name: S

Uniprot No: P0DTC2

Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source: Mammalian cell

Tag Info: C-terminal 10xHis-tagged

Expression Region: 319-541aa (G476S)

Sequence Description: Partial

Target Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQASSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Mol. Weight: 27.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (G476S) at 5 μg/ml can bind human ACE2 (CSB-MP866317HU), the EC50 is 47.11-92.3 ng/ml.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

View AllClose

0 Reviews

View AllClose