Recombinant Human Novel Coronavirus Spike glycoprotein (S) (E484K), partial (Active) | CSB-MP3324GMY1 (M8)h8

(No reviews yet) Write a Review
SKU:
CSB-MP3324GMY1 (M8)h8
Availability:
3 - 7 Working Days
€112.00 - €3,025.00

Description

Recombinant Human Novel Coronavirus Spike glycoprotein (S) (E484K), partial (Active) | CSB-MP3324GMY1 (M8)h8 | Cusabio

Target Name: S

Uniprot No: P0DTC2

Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source: Mammalian cell

Tag Info: C-terminal mFc-tagged

Expression Region: 319-541aa (E484K)

Sequence Description: Partial

Target Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Mol. Weight: 54.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2 (CSB-MP866317HU-B), the EC50 is 6.597-8.187 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody (CSB-RA33245D1GMY), the EC50 is 21.54-26.77 ng/ml.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

View AllClose

0 Reviews

View AllClose