Recombinant Human Neurotrophin-4 (NTF4), partial | CSB-EP016121HU1

(No reviews yet) Write a Review
SKU:
CSB-EP016121HU1
Availability:
13 - 23 Working Days
  • Recombinant Human Neurotrophin-4 (NTF4), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Neurotrophin-4 (NTF4), partial | CSB-EP016121HU1 | Cusabio

Alternative Name(s): Neurotrophin-5 ;NT-5Neutrophic factor 4

Gene Names: NTF4

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 82-210aa

Sequence Info: Partial

MW: 17.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Target-derived survival factor for peripheral sensory sympathetic neurons.

Reference: Neurotrophin-5 a novel neurotrophic factor that activates trk and trkB.Berkemeier L.R., Winslow J.W., Kaplan D.R., Nikolics K., Goeddel D.V., Rosenthal A.Neuron 7:857-866(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Target-derived survival factor for peripheral sensory sympathetic neurons.

Involvement in disease: Glaucoma 1, open angle, O (GLC1O)

Subcellular Location: Secreted

Protein Families: NGF-beta family

Tissue Specificity: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues.

Paythway: MAPKsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P34130

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose