Recombinant Human Neuroserpin protein (SERPINI1) (Active) | CSB-AP000141HU

(No reviews yet) Write a Review
SKU:
CSB-AP000141HU
Availability:
5 to 10 Working Days
  • Recombinant Human Neuroserpin protein (SERPINI1) (Active)
  • Recombinant Human Neuroserpin protein (SERPINI1) (Active) | CSB-AP000141HU
$230.40 - $2,161.20

Description

Recombinant Human Neuroserpin protein (SERPINI1) (Active) | CSB-AP000141HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Peptidase inhibitor 12, Serpin I1

Gene Names: SERPINI1,PI12

Research Areas: Neuroscience

Species: Homo sapiens (Human)

Source: E.Coli

Tag Info: Tag-Free

Expression Region: 17-410aa

Sequence Info: TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2000 IU/mg.

MW: 44.7 kDa

Purity: >95% as determined by SDS-PAGE and HPLC.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator.

PubMed ID: 9070919; 14702039; 17974005; 15489334; 10517635

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin

Involvement in disease: Encephalopathy, familial, with neuroserpin inclusion bodies (FENIB)

Subcellular Location: Secreted, Cytoplasmic vesicle, secretory vesicle lumen, Perikaryon

Protein Families: Serpin family

Tissue Specificity: Detected in brain cortex and hippocampus pyramidal neurons (at protein level) (PubMed:17040209) . Predominantly expressed in the brain (PubMed:9070919) .

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.5

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99574

Uniprot Entry Name: NEUS_HUMAN

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose