Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial | CSB-EP005393HUa0

(No reviews yet) Write a Review
SKU:
CSB-EP005393HUa0
Availability:
13 - 23 Working Days
£238.40 - £1,361.60

Description

Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial | CSB-EP005393HUa0 | Cusabio

Alternative Name(s): Neuronal acetylcholine receptor subunit alpha-7

Gene Names: CHRNA7

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-230aa

Sequence Info: Partial

MW: 30.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin.

Reference: "Alpha-conotoxins ImI and ImII target distinct regions of the human alpha7 nicotinic acetylcholine receptor and distinguish human nicotinic receptor subtypes." Ellison M., Gao F., Wang H.L., Sine S.M., McIntosh J.M., Olivera B.M. Biochemistry 43:16019-16026(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P36544

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose