Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial | CSB-EP005389HU1

(No reviews yet) Write a Review
SKU:
CSB-EP005389HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial | CSB-EP005389HU1 | Cusabio

Alternative Name(s): ACHA3_HUMAN; AChR; Cholinergic receptor neuronal nicotinic alpha polypeptide 3; Cholinergic receptor nicotinic alpha 3; Cholinergic receptor nicotinic alpha polypeptide 3; CHRNA 3; CHRNA3; LNCR2; MGC104879; NACHRA 3; NACHRA3; Neuronal acetylcholine receptor protein alpha 3 chain precursor; Neuronal acetylcholine receptor subunit alpha 3; Neuronal acetylcholine receptor subunit alpha-3; Neuronal nicotinic acetylcholine receptor alpha 3 subunit; PAOD2

Gene Names: CHRNA3

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 32-240aa

Sequence Info: Extracellular Domain

MW: 44.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Reference: "Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor." Mihovilovic M., Roses A.D. Exp. Neurol. 111:175-180(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Involvement in disease:

Subcellular Location: Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein

Protein Families: Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-3/CHRNA3 sub-subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P32297

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose