Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (NDUFV2), partial | CSB-RP053854h

Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (NDUFV2), partial | CSB-RP053854h | Cusabio

Alternative Name(s): NADH-ubiquinone oxidoreductase 24KDA subunit

Gene Names: NDUFV2

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 35-249aa

Sequence Info: Partial

MW: 50.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Core subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assbly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone .

Reference: Mitochondrial c-Src regulates cell survival through phosphorylation of respiratory chain components.Ogura M., Yamaki J., Homma M.K., Homma Y.Biochem. J. 447:281-289(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane

Protein Families: Complex I 24 kDa subunit family

Tissue Specificity:

Paythway: OxidativePhosphorylation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19404

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM