Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 (NDUFA2), partial | CSB-RP029854h

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 (NDUFA2), partial | CSB-RP029854h | Cusabio

Alternative Name(s): Complex I-B8 ;CI-B8NADH-ubiquinone oxidoreductase B8 subunit

Gene Names: NDUFA2

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 4-99aa

Sequence Info: Partial

MW: 37.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Reference: Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits.Ton C., Hwang D.M., Dempsey A.A., Liew C.-C.Biochem. Biophys. Res. Commun. 241:589-594(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane, Peripheral membrane protein, Matrix side

Protein Families: Complex I NDUFA2 subunit family

Tissue Specificity:

Paythway: OxidativePhosphorylation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43678

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM