Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active) | CSB-AP000101HU

(No reviews yet) Write a Review
SKU:
CSB-AP000101HU
Availability:
5 to 10 Working Days
  • Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)
  • Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active) | CSB-AP000101HU
$230.40 - $2,569.20

Description

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active) | CSB-AP000101HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : NAD-ME, Malic enzyme 2

Gene Names: ME2

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.Coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 19-584aa

Sequence Info: MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH

Biological Activity: Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975) . The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM

MW: 64.4 kDa

Purity: >95% as determined by SDS-PAGE and HPLC.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance:

PubMed ID: 1993674; 11401430; 14702039; 16177791; 15489334; 12665801; 19608861; 21269460; 24275569; 10467136; 10700286; 12121650; 12962632

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location: Mitochondrion matrix

Protein Families: Malic enzymes family

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2μm filtered PBS, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P23368

Uniprot Entry Name: MAOM_HUMAN

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose