Recombinant Human N (6) -adenine-specific DNA methyltransferase 2 (N6AMT2) | CSB-EP819896HU

Recombinant Human N (6) -adenine-specific DNA methyltransferase 2 (N6AMT2) | CSB-EP819896HU | Cusabio

Alternative Name(s): N(6)-adenine-specific DNA methyltransferase 2

Gene Names: N6AMT2

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: SDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-214aa

Sequence Info: Full Length of Mature Protein

MW: 40.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that methylates elongation factor 1-alpha.

Reference: Transcriptome analysis of a cDNA library from adult human epididymis.Li J.Y., Wang H.Y., Liu J., Liu Q., Zhang J.S., Wan F.C., Liu F.J., Jin S.H., Zhang Y.L.DNA Res. 15:115-122(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79'.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Class I-like SAM-binding methyltransferase superfamily, EFM5 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8WVE0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM