Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial | CSB-RP100574h

Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial | CSB-RP100574h | Cusabio

Alternative Name(s): Cardiac myosin light chain-2; Cardiac ventricular myosin light chain 2; CMH10; MLC 2v ; MLC-2; MLC-2v; MLC2; MLRV_HUMAN; MYL 2; MYL2; Myosin light chain 2 regulatory cardiac slow; Myosin light polypeptide 2 regulatory cardiac slow; Myosin regulatory light chain 2; Myosin regulatory light chain 2 ventricular/cardiac muscle isoform; Regulatory light chain of myosin; RLC of myosin; Slow cardiac myosin regulatory light chain 2; ventricular/cardiac muscle isoform

Gene Names: MYL2

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 8-164aa

Sequence Info: Partial

MW: 21.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: ErratumRichard P., Charron P., Carrier L., Ledeuil C., Cheav T., Pichereau C., Benaiche A., Isnard R., Dubourg O., Burban M., Gueffet J.-P., Millaire A., Desnos M., Schwartz K., Hainque B., Komajda M.Circulation 109:3258-3258(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Contractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).

Involvement in disease: Cardiomyopathy, familial hypertrophic 10 (CMH10)

Subcellular Location: Cytoplasm, myofibril, sarcomere, A band

Protein Families:

Tissue Specificity:

Paythway: Cardiacmusclecontraction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10916

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM