Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform (MYLPF) | CSB-EP856892HU

Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform (MYLPF) | CSB-EP856892HU | Cusabio

Alternative Name(s): Fast skeletal myosin light chain 2MLC2B

Gene Names: MYLPF

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: APKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-169aa

Sequence Info: Full Length of Mature Protein

MW: 34.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Human fast skeletal myosin light chain 2 cDNA isolation, tissue specific expression of the single copy gene, comparative sequence analysis of isoforms and evolutionary relationships.Sachdev S., Raychowdhury M.K., Sarkar S.DNA Seq. 14:339-350(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: Expressed in fetal and adult skeletal muscle.

Paythway: Focaladhesion

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96A32

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM