Recombinant Human Myosin light polypeptide 6 (MYL6), partial | CSB-RP051544h

Recombinant Human Myosin light polypeptide 6 (MYL6), partial | CSB-RP051544h | Cusabio

Alternative Name(s): 17KDA myosin light chain ;LC17Myosin light chain 3 ;MLC-3Myosin light chain alkali 3 ;Myosin light chain A3Smooth muscle and nonmuscle myosin light chain alkali 6

Gene Names: MYL6

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 3-151aa

Sequence Info: Partial

MW: 43.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Regulatory light chain of myosin. Does not bind calcium.

Reference: The alkali light chains of human smooth and nonmuscle myosins are encoded by a single gene. Tissue-specific expression by alternative splicing pathways.Lenz S., Lohse P., Seidel U., Arnold H.H.J. Biol. Chem. 264:9009-9015(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulatory light chain of myosin. Does not bind calcium.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway: Vascularsmoothmusclecontraction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P60660

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM