Recombinant Human Myelin proteolipid protein (PLP1) | CSB-CF018202HU

Recombinant Human Myelin proteolipid protein (PLP1) | CSB-CF018202HU | Cusabio

Alternative Name(s): Lipophilin PLP

Gene Names: PLP1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 2-277aa

Sequence Info: Full Length of Mature Protein

MW: 35.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.

Reference: "Individual exons encode the integral membrane domains of human myelin proteolipid protein." Diehl H.-J., Schaich M., Budzinski R.-M., Stoffel W. Proc. Natl. Acad. Sci. U.S.A. 83:9807-9811(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.

Involvement in disease: Leukodystrophy, hypomyelinating, 1 (HLD1); Spastic paraplegia 2, X-linked (SPG2)

Subcellular Location: Cell membrane, Multi-pass membrane protein, Myelin membrane

Protein Families: Myelin proteolipid protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P60201

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM