Recombinant Human Myelin protein P0 (MPZ) , partial | CSB-EP014774HUe0

(No reviews yet) Write a Review
SKU:
CSB-EP014774HUe0
Availability:
13 - 23 Working Days
  • Recombinant Human Myelin protein P0 (MPZ) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Myelin protein P0 (MPZ) , partial | CSB-EP014774HUe0 | Cusabio

Alternative Name(s): Myelin peripheral protein ;MPPMyelin protein zero

Gene Names: MPZ

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 30-156aa

Sequence Info: Partial

MW: 41.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Creation of an Extracellular domain mbrane face which guides the wrapping process and ultimately compacts adjacent lamellae.

Reference: Isolation and sequence determination of cDNA encoding the major structural protein of human peripheral myelin.Hayasaka K., Nanao K., Tahara M., Sato W., Takada G., Miura M., Uyemura K.Biochem. Biophys. Res. Commun. 180:515-518(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction.

Involvement in disease: Charcot-Marie-Tooth disease 1B (CMT1B); Charcot-Marie-Tooth disease 2I (CMT2I); Charcot-Marie-Tooth disease 2J (CMT2J); Adie pupil (ADIEP); Charcot-Marie-Tooth disease, dominant, intermediate type, D (CMTDID); Dejerine-Sottas syndrome (DSS); Neuropathy, congenital hypomyelinating or amyelinating (CHN); Roussy-Levy syndrome (ROULS)

Subcellular Location: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform L-MPZ: Myelin membrane, Single-pass type I membrane protein

Protein Families: Myelin P0 protein family

Tissue Specificity: Found only in peripheral nervous system Schwann cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25189

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose