Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG), partial | CSB-EP619083HU

(No reviews yet) Write a Review
SKU:
CSB-EP619083HU
Availability:
13 - 23 Working Days
$294.00 - $1,532.40

Description

Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG), partial | CSB-EP619083HU | Cusabio

Alternative Name(s): BTN6; BTNL11; MGC26137; MOG alpha 5; MOG alpha 6; MOG AluA; MOG AluB; MOG; MOG Ig AluB; MOG_HUMAN; MOGIG2; Myelin oligodendrocyte glycoprotein; Myelin-oligodendrocyte glycoprotein; NRCLP7

Gene Names: MOG

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 30-154aa

Sequence Info: Full Length of Mature Protein

MW: 17.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.

Reference: "Identification of the myelin oligodendrocyte glycoprotein as a cellular receptor for rubella virus." Cong H., Jiang Y., Tien P. J. Virol. 85:11038-11047(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q16653

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose