Recombinant Human Muscarinic acetylcholine receptor M3 (CHRM3), partial | CSB-EP005383HU

(No reviews yet) Write a Review
SKU:
CSB-EP005383HU
Availability:
3 - 7 Working Days
  • Recombinant Human Muscarinic acetylcholine receptor M3 (CHRM3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Muscarinic acetylcholine receptor M3 (CHRM3), partial | CSB-EP005383HU | Cusabio

Alternative Name(s): AChR; ACM3_HUMAN; cholinergic receptor muscarinic 3; CHRM 3; CHRM3; EGBRS; HM 3; HM3; m3 muscarinic acetylcholine receptor; M3 muscarinic receptor; muscarinic 3; Muscarinic acetylcholine receptor M3; muscarinic cholinergic m3 receptor; muscarinic m3 receptor

Gene Names: CHRM3

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 253-492aa

Sequence Info: Partial

MW: 40.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.

Reference: "Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors." Peralta E.G., Ashkenazi A., Winslow J.W., Smith D.H., Ramachandran J., Capon D.J. EMBO J. 6:3923-3929(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.

Involvement in disease: Prune belly syndrome (PBS)

Subcellular Location: Cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Basolateral cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily

Tissue Specificity:

Paythway: Calciumsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20309

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose