Recombinant Human Mitochondrial ornithine transporter 1 (SLC25A15) | CSB-EP897578HU

Recombinant Human Mitochondrial ornithine transporter 1 (SLC25A15) | CSB-EP897578HU | Cusabio

Alternative Name(s): Solute carrier family 25 member 15

Gene Names: SLC25A15

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-301aa

Sequence Info: Full Length

MW: 59.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.

Reference: "Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is caused by mutations in a gene encoding a mitochondrial ornithine transporter." Camacho J.A., Obie C., Biery B., Goodman B.K., Hu A., Almashanu S., Steel G., Casey R., Lombard M., Mitchell G.A., Valle D. Nat. Genet. 22:151-158(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.

Involvement in disease: Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome (HHH syndrome)

Subcellular Location: Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families: Mitochondrial carrier (TC 2.A.29) family

Tissue Specificity: Highly expressed in liver, pancreas, testis, lung and small intestine. Lower levels are detected in spleen, kidney, brain and heart.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y619

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM