Cusabio Human Recombinants
Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19) | CSB-EP853400HU
- SKU:
- CSB-EP853400HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19) | CSB-EP853400HU | Cusabio
Alternative Name(s): DnaJ homolog subfamily C member 19
Gene Names: DNAJC19
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-116aa
Sequence Info: Full Length
MW: 39.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity
Reference: "Characterization of the human heart mitochondrial proteome." Taylor S.W., Fahy E., Zhang B., Glenn G.M., Warnock D.E., Wiley S., Murphy A.N., Gaucher S.P., Capaldi R.A., Gibson B.W., Ghosh S.S. Nat. Biotechnol. 21:281-286(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity).
Involvement in disease: 3-methylglutaconic aciduria 5 (MGA5)
Subcellular Location: Mitochondrion inner membrane, Single-pass membrane protein
Protein Families: TIM14 family
Tissue Specificity: Ubiquitously expressed.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q96DA6
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM