Recombinant Human Mitochondrial brown fat uncoupling protein 1 (UCP1) | CSB-EP025554HU

Recombinant Human Mitochondrial brown fat uncoupling protein 1 (UCP1) | CSB-EP025554HU | Cusabio

Alternative Name(s): Solute carrier family 25 member 7Thermogenin

Gene Names: UCP1

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-307aa

Sequence Info: Full Length of Mature Protein

MW: 48.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial mbrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.

Reference: Uncoupling protein 1 and 3 polymorphisms are associated with waist-to-hip ratio.Herrmann S.M., Wang J.G., Staessen J.A., Kertmen E., Schmidt-Petersen K., Zidek W., Paul M., Brand E.J. Mol. Med. 81:327-332(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates to non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance (By similarity). Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families: Mitochondrial carrier (TC 2.A.29) family

Tissue Specificity: Brown adipose tissue.

Paythway: PPARsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25874

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM