Recombinant Human Methionine-R-sulfoxide reductase B3 (MSRB3) | CSB-EP810290HU

(No reviews yet) Write a Review
SKU:
CSB-EP810290HU
Availability:
13 - 23 Working Days
  • Recombinant Human Methionine-R-sulfoxide reductase B3 (MSRB3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Methionine-R-sulfoxide reductase B3 (MSRB3) | CSB-EP810290HU | Cusabio

Alternative Name(s): Deafness, Autosomal Recessive 74; DFNB74; FLJ36866; Methionine R sulfoxide reductase B mitochondrial; Methionine sulfoxide reductase B3; Methionine-R-sulfoxide reductase B3; MsrB3; MSRB3_HUMAN

Gene Names: MSRB3

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-185aa

Sequence Info: Full Length of Isoform 2

MW: 47 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.

Reference: "Methionine sulfoxide reduction in mammals: characterization of methionine-R-sulfoxide reductases." Kim H.-Y., Gladyshev V.N. Mol. Biol. Cell 15:1055-1064(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.

Involvement in disease: Deafness, autosomal recessive, 74 (DFNB74)

Subcellular Location: Isoform 1: Endoplasmic reticulum, SUBCELLULAR LOCATION: Isoform 2: Mitochondrion

Protein Families: MsrB Met sulfoxide reductase family

Tissue Specificity: Widely expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8IXL7

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose