Cusabio Human Recombinants
Recombinant Human Metallothionein-1X (MT1X), partial | CSB-YP015119HU
- SKU:
- CSB-YP015119HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Metallothionein-1X (MT1X), partial | CSB-YP015119HU | Cusabio
Alternative Name(s): Metallothionein-IX ;MT-IX
Gene Names: MT1X
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-59aa
Sequence Info: Partial
MW: 7.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Reference: Induction by zinc of specific metallothionein isoforms in human monocytes.Pauwels M., van Weyenbergh J., Soumillion A., Proost P., Ley M.Eur. J. Biochem. 220:105-110(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. May be involved in FAM168A anti-apoptotic signaling
Involvement in disease:
Subcellular Location:
Protein Families: Metallothionein superfamily, Type 1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P80297
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM