Recombinant Human Metalloreductase STEAP1 (STEAP1), partial | CSB-RP133544h

Recombinant Human Metalloreductase STEAP1 (STEAP1), partial | CSB-RP133544h | Cusabio

Alternative Name(s): Six-transmembrane epithelial antigen of prostate 1

Gene Names: STEAP1

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 3-69aa

Sequence Info: Partial

MW: 35 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor .

Reference: The Steap proteins are metalloreductases.Ohgami R.S., Campagna D.R., McDonald A., Fleming M.D.Blood 108:1388-1394(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor (By similarity).

Involvement in disease:

Subcellular Location: Endosome membrane, Multi-pass membrane protein

Protein Families: STEAP family

Tissue Specificity: Ubiquitously expressed. Highly expressed in prostate tumors.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UHE8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM