Recombinant Human Metalloreductase STEAP1 (STEAP1) | CSB-CF890691HU

(No reviews yet) Write a Review
SKU:
CSB-CF890691HU
Availability:
18 - 23 Working Days
  • Recombinant Human Metalloreductase STEAP1 (STEAP1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$1,761.60 - $2,809.20

Description

Recombinant Human Metalloreductase STEAP1 (STEAP1) | CSB-CF890691HU | Cusabio

Alternative Name(s): Six-transmembrane epithelial antigen of prostate 1

Gene Names: STEAP1

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged

Expression Region: 1-339aa

Sequence Info: Full Length

MW: 58.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor

Reference: "STEAP: a prostate-specific cell-surface antigen highly expressed in human prostate tumors." Hubert R.S., Vivanco I., Chen E., Rastegar S., Leong K., Mitchell S.C., Madraswala R., Zhou Y., Kuo J., Raitano A.B., Jakobovits A., Saffran D.C., Afar D.E.H. Proc. Natl. Acad. Sci. U.S.A. 96:14523-14528(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor (By similarity).

Involvement in disease:

Subcellular Location: Endosome membrane, Multi-pass membrane protein

Protein Families: STEAP family

Tissue Specificity: Ubiquitously expressed. Highly expressed in prostate tumors.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UHE8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose