Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8), partial | CSB-EP844087HU1

(No reviews yet) Write a Review
SKU:
CSB-EP844087HU1
Availability:
13 - 23 Working Days
  • Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Human Major facilitator superfamily domain-containing protein 8 (MFSD8), partial | CSB-EP844087HU1 | Cusabio

Alternative Name(s): Ceroid-lipofuscinosis neuronal protein 7

Gene Names: MFSD8

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 1-40aa

Sequence Info: Partial

MW: 34.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be a carrier that transport small solutes by using chemiosmotic ion gradients

Reference: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be a carrier that transport small solutes by using chemiosmotic ion gradients.

Involvement in disease: Ceroid lipofuscinosis, neuronal, 7 (CLN7); Macular dystrophy with central cone involvement (CCMD)

Subcellular Location: Lysosome membrane, Multi-pass membrane protein

Protein Families: Major facilitator superfamily

Tissue Specificity: Expressed at very low levels in all tissues tested.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8NHS3

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose