Recombinant Human Macrophage migration inhibitory factor (MIF) | CSB-YP013826HU

(No reviews yet) Write a Review
SKU:
CSB-YP013826HU
Availability:
3 - 7 Working Days
€262.00 - €943.00

Description

Recombinant Human Macrophage migration inhibitory factor (MIF) | CSB-YP013826HU | Cusabio

Alternative Name(s): Glycosylation-inhibiting factor Short name: GIF L-dopachrome isomerase L-dopachrome tautomerase (EC:5.3.3.12) Phenylpyruvate tautomerase MIF GLIF, MMIF

Gene Names: MIF

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-115aa

Sequence Info: Full Length of Mature Protein

MW: 14.4

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.

Reference:

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14174

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose