Recombinant Human Macrophage migration inhibitory factor (MIF) (Active) | CSB-MP013826HU

Recombinant Human Macrophage migration inhibitory factor (MIF) (Active) | CSB-MP013826HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : (MIF) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase) (Phenylpyruvate tautomerase)

Gene Names: MIF

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 2-115aa

Sequence Info: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody（CSB-RA146975A0HU）, the EC50 is 49.61-69.45 ng/ml.

MW: 41.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro) , but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14174

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A