Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA) | CSB-YP012972HU

(No reviews yet) Write a Review
SKU:
CSB-YP012972HU
Availability:
3 - 7 Working Days
  • Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$314.40 - $1,131.60

Description

Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA) | CSB-YP012972HU | Cusabio

Alternative Name(s): Cholesteryl esterase Lipase A Sterol esterase

Gene Names: LIPA

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-399aa

Sequence Info: Full Length of Mature Protein

MW: 45 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.

Reference: "Tissue and cellular specific expression of murine lysosomal acid lipase mRNA and protein." Du H., Witte D.P., Grabowski G.A. J. Lipid Res. 37:937-949(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.

Involvement in disease: Wolman disease (WOD); Cholesteryl ester storage disease (CESD)

Subcellular Location: Lysosome

Protein Families: AB hydrolase superfamily, Lipase family

Tissue Specificity:

Paythway: Cholesterolmetabolism

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P38571

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose