null

Recombinant Human Lymphotoxin-alpha (LTA) (Active) | CSB-MP013218HU

(No reviews yet) Write a Review
SKU:
CSB-MP013218HU
Availability:
3 to 7 Working Days
  • Recombinant Human Lymphotoxin-alpha (LTA) (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$250.80 - $406.80
Frequently bought together:

Description

Recombinant Human Lymphotoxin-alpha (LTA) (Active) | CSB-MP013218HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) :

Gene Names: LTA

Research Areas: Cytokine

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 35-205aa

Sequence Info: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B (CSB-MP023978HU2) , the EC50 is 1.632-2.699 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFR1(CSB-MP023977HU1), the EC50 of human LTA protein is 4.409-6.797 ng/ml.

MW: 20.8

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01374

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose