Recombinant Human Lymphocyte antigen 96 (LY96) | CSB-BP013254HU(M)

(No reviews yet) Write a Review
SKU:
CSB-BP013254HU(M)
Availability:
28 - 38 Working Days
$531.60 - $1,272.00

Description

Recombinant Human Lymphocyte antigen 96 (LY96) | CSB-BP013254HU(M) | Cusabio

Alternative Name(s): ESOP-1 (Protein MD-2) (ESOP1) (MD2)

Gene Names: LY96

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

Expression Region: 19-160aa

Sequence Info: Full Length of Mature Protein

MW: 17.5

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Binds bacterial lipopolysaccharide . Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide , and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria . Enhances TLR4-dependent activation of NF-kappa-B . Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS .

Reference: "Natural selection in the TLR-related genes in the course of primate evolution." Nakajima T., Ohtani H., Satta Y., Uno Y., Akari H., Ishida T., Kimura A. Immunogenetics 60:727-735(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y6Y9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose