Recombinant Human Lymphocyte antigen 6H (LY6H) | CSB-YP013249HU

(No reviews yet) Write a Review
SKU:
CSB-YP013249HU
Availability:
25 - 35 Working Days
  • Recombinant Human Lymphocyte antigen 6H (LY6H)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$406.80 - $1,614.00

Description

Recombinant Human Lymphocyte antigen 6H (LY6H) | CSB-YP013249HU | Cusabio

Alternative Name(s): Short name: Ly-6H

Gene Names: LY6H

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-115aa

Sequence Info: Full Length of Mature Protein

MW: 11.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Isolation and characterization of a new member of the human Ly6 gene family (LY6H)."Horie M., Okutomi K., Taniguchi Y., Ohbuchi Y., Suzuki M., Takahashi E.Genomics 53:365-368(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families:

Tissue Specificity: Highly expressed in brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. Also found in lower levels in testis, pancreas, small intestine and colon.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O94772

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose